PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr017204.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 419aa    MW: 47277.8 Da    PI: 5.9816
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr017204.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1423.5e-441002252128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                  ppG+rF+P d el+v+yL kkv +++l+  + i ev++y+++P+ L +k+++  ++wyfF++rd+ky++g+r++ra+ +gyWkatg dkev+s +g++
  Pbr017204.1 100 PPGYRFNPFDGELIVHYLMKKVLDQPLPP-NRIFEVNLYRYNPEVLAEKYEKYGDKWYFFTPRDRKYRNGSRPKRAAGDGYWKATGADKEVKSFDGAV 196
                  9*************************999.77**************988888889******************************************* PP

          NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                  vg +k Lvfy+g+ pkg kt+W+mhe+++
  Pbr017204.1 197 VGSRKALVFYRGKPPKGDKTNWIMHEFKV 225
                  ***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-5297252IPR003441NAC domain
PROSITE profilePS5100552.41999252IPR003441NAC domain
PfamPF023654.8E-23100224IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MSSPSESPTM EPVEQSHPDH KASVTIITQQ VASYSLSPNK QSPAQGDQGL FTPTSETGVS  60
LTTNVSAAAG GTYHELSEDE ANSLHNNLIR DQDDFFNSFP PGYRFNPFDG ELIVHYLMKK  120
VLDQPLPPNR IFEVNLYRYN PEVLAEKYEK YGDKWYFFTP RDRKYRNGSR PKRAAGDGYW  180
KATGADKEVK SFDGAVVGSR KALVFYRGKP PKGDKTNWIM HEFKVKDSPV RSRRGENDMR  240
LDNWVLCRIY KKDGNNGKRC ESRNHAEIHS PFPHRINDES MEIEMSGDIV DPLPEYDPAL  300
EYDHKYSYIP YPLMASQPNI SGGLPVNMIS NNRIQSVEAA SVNAGSCYAN MGYSQPICVR  360
PPLMSSESVL GPYRYIDEST ILQDDMIFGM KGFEHSLYST NNYAGQFSAL DNVFPYTE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-499825816171NO APICAL MERISTEM PROTEIN
1ut4_B1e-499825816171NO APICAL MERISTEM PROTEIN
1ut7_A1e-499825816171NO APICAL MERISTEM PROTEIN
1ut7_B1e-499825816171NO APICAL MERISTEM PROTEIN
3swm_A1e-499825819174NAC domain-containing protein 19
3swm_B1e-499825819174NAC domain-containing protein 19
3swm_C1e-499825819174NAC domain-containing protein 19
3swm_D1e-499825819174NAC domain-containing protein 19
3swp_A1e-499825819174NAC domain-containing protein 19
3swp_B1e-499825819174NAC domain-containing protein 19
3swp_C1e-499825819174NAC domain-containing protein 19
3swp_D1e-499825819174NAC domain-containing protein 19
4dul_A1e-499825816171NAC domain-containing protein 19
4dul_B1e-499825816171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009374955.10.0PREDICTED: NAC domain-containing protein 68-like
TrEMBLM5X9E71e-146M5X9E7_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101121642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.16e-58NAC domain containing protein 32